Package: malaviR 1.0.0
malaviR: An R interface to MalAvi
Functions for working with data from the MalAvi database of avian haemosporidian parasites.
Authors:
malaviR_1.0.0.tar.gz
malaviR_1.0.0.zip(r-4.7)malaviR_1.0.0.zip(r-4.6)malaviR_1.0.0.zip(r-4.5)
malaviR_1.0.0.tgz(r-4.6-any)malaviR_1.0.0.tgz(r-4.5-any)
malaviR_1.0.0.tar.gz(r-4.7-any)malaviR_1.0.0.tar.gz(r-4.6-any)
malaviR_1.0.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
card.svg |card.png
malaviR/json (API)
| # Install 'malaviR' in R: |
| install.packages('malaviR', repos = c('https://vincenzoaellis.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/vincenzoaellis/malavir/issues
- taxonomy - MalAvi host species matched to the clootl (eBird) taxonomy
Last updated from:b9d3de84d1. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 234 | ||
| source / vignettes | OK | 209 | ||
| linux-release-x86_64 | OK | 188 | ||
| macos-release-arm64 | OK | 196 | ||
| macos-oldrel-arm64 | OK | 155 | ||
| windows-devel | OK | 190 | ||
| windows-release | OK | 189 | ||
| windows-oldrel | OK | 179 | ||
| wasm-release | OK | 125 |
Exports:blast_malaviclean_alignmentclean_namesclootl_taxonomy_versionextract_alignmentextract_tablemalavi_versionmatch_taxonomysister_taxasynonymy_report
Dependencies:apeclidigestdplyrgenericsgluelatticelifecyclemagrittrnlmepillarpkgconfigR6Rcpprlangtibbletidyselectutf8vctrswithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| BLAST-like search of a sequence against MalAvi | blast_malavi |
| Identify and collapse repeated haplotypes in a MalAvi alignment | clean_alignment |
| Clean MalAvi lineage names to match the tables | clean_names |
| Version of the clootl taxonomy bundled in the package | clootl_taxonomy_version |
| Get the MalAvi sequence alignment | extract_alignment |
| Get a MalAvi data table | extract_table |
| MalAvi database version bundled in the package | malavi_version |
| Match host species names to the clootl (eBird) avian taxonomy | match_taxonomy |
| Identify the sister taxa at a node in a phylogeny | sister_taxa |
| Quantify MalAvi haplotype synonymies for investigation | synonymy_report |
| MalAvi host species matched to the clootl (eBird) taxonomy | taxonomy |
